ALKBH6 (NM_032878) Human Recombinant Protein
CAT#: TP324553
Recombinant protein of human alkB, alkylation repair homolog 6 (E. coli) (ALKBH6), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224553 representing NM_032878
Red=Cloning site Green=Tags(s) MAGRGMGMLNLEIGGDAGGRIGCKELVLMEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQV FNAPKPKWTQLSGRKLQNWGGLPHPRGMVPERLPPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIM PHEDGPLYYPTVSTISLGSHTVLDFYEPRRPEDDDPTEQPRPPPRPTTSLLLEPRSLLVLRGPAYTRLLH GIAAARVDALDAASSPPNAAACPSARPGACLVRGTRVSLTIRRVPRVLRAGLLLGK SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 29.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_116267 |
Locus ID | 84964 |
UniProt ID | Q3KRA9 |
Cytogenetics | 19q13.12 |
Refseq Size | 980 |
Refseq ORF | 798 |
Synonyms | ABH6 |
Summary | Probable dioxygenase that requires molecular oxygen, alpha-ketoglutarate and iron.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404763 | ALKBH6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC409909 | ALKBH6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY404763 | Transient overexpression lysate of alkB, alkylation repair homolog 6 (E. coli) (ALKBH6), transcript variant 1 |
USD 436.00 |
|
LY409909 | Transient overexpression lysate of alkB, alkylation repair homolog 6 (E. coli) (ALKBH6), transcript variant 2 |
USD 436.00 |
|
PH321937 | ALKBH6 MS Standard C13 and N15-labeled recombinant protein (NP_942567) |
USD 3,255.00 |
|
PH324553 | ALKBH6 MS Standard C13 and N15-labeled recombinant protein (NP_116267) |
USD 3,255.00 |
|
TP321937 | Recombinant protein of human alkB, alkylation repair homolog 6 (E. coli) (ALKBH6), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review