PD L2 (PDCD1LG2) (NM_025239) Human Recombinant Protein

SKU TP324141L

Recombinant protein of human programmed cell death 1 ligand 2 (PDCD1LG2), 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC224141 representing NM_025239; Red=Cloning site Green=Tags(s); ; MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHR; ERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVE; LTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQ; SQMEPRTHPTWLLHIFIPSCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 30.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_079515
• Locus ID: 80380
• UniProt ID: Q9BQ51
• Cytogenetics: 9p24.1
• RefSeq Size: 1518
• RefSeq ORF: 819
• Synonyms: B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
• Summary: Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs)