ACCN5 (ASIC5) (NM_017419) Human Recombinant Protein

CAT#: TP323871

Recombinant protein of human amiloride-sensitive cation channel 5, intestinal (ACCN5), 20 µg

Size: 20 ug 100 ug 1 mg


  View other "ACCN5" proteins (3)

USD 867.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Rabbit polyclonal Anti-ACCN5 Antibody
    • 100 ul

USD 485.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "ACCN5"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC223871 representing NM_017419
Red=Cloning site Green=Tags(s)

MEQTEKSKVYAENGLLEKIKLCPSKKPLPSPTERKKFDYDFAISTSFHGIHNIVQNRSKIRRVLWLVVVL
GSVSLVTWQIYIRLLNYFTWPTTASIEVQYVEKMEFPTVTFCNLNRFQTDAVAKFGVIFFLWHIVSKVLH
LQEITANSTGSREATDFAASHQNFSIVEFIRNKGFYLNNSTLLDCEFFGKPCSPKDFAHVFTEYGNCFTF
NHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVDAGIIFVIHSPKKVPQFDGLGLLSPVGMHAR
VTIRQVKTVHQEYPWGECNPNIKLQNFSSYSTSGCLKECKAQHIKKQCGCVPFLLPGYGIECDLQKYFSC
VSPVLDHIEFKDLCTVGTHNSSCPVSCEEIEYPATISYSSFPSQKALKYLSKKLNQSRKYIRENLVKIEI
NYSDLNYKITQQQKAVSVSELLADLGGQLGLFCGASLITIIEIIEYLFTNFYWICIFFLLKISEMTQWTP
PPQNHLGNKNRIEEC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 57.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_059115
Locus ID 51802
UniProt ID Q9NY37
Cytogenetics 4q32.1
Refseq Size 1692
Refseq ORF 1515
Synonyms ACCN5; HINAC; INAC
Summary This gene belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Ion Channels: Other, Transmembrane

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.