C7orf53 (LSMEM1) (NM_182597) Human Recombinant Protein
CAT#: TP323802
Recombinant protein of human chromosome 7 open reading frame 53 (C7orf53), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223802 representing NM_182597
Red=Cloning site Green=Tags(s) MTHSSQDTGSCGIQEDGKLYVVDSINDLNKLNLCPAGSQHLFPLEDKIPVLGTNSGNGSRSLFFVGLLIV LIVSLALVFFVIFLIVQTGNKMDDVSRRLTAEGKDIDDLKRINNMIVKRLNQLNQLDSEQN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_872403 |
Locus ID | 286006 |
UniProt ID | Q8N8F7 |
Cytogenetics | 7q31.1 |
Refseq Size | 1691 |
Refseq ORF | 393 |
Synonyms | C7orf53 |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403647 | LSMEM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427449 | LSMEM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403647 | Transient overexpression lysate of chromosome 7 open reading frame 53 (C7orf53), transcript variant 1 |
USD 436.00 |
|
LY427449 | Transient overexpression lysate of chromosome 7 open reading frame 53 (C7orf53), transcript variant 2 |
USD 436.00 |
|
PH323802 | C7orf53 MS Standard C13 and N15-labeled recombinant protein (NP_872403) |
USD 3,255.00 |
|
PH325094 | C7orf53 MS Standard C13 and N15-labeled recombinant protein (NP_001127940) |
USD 3,255.00 |
|
TP325094 | Recombinant protein of human chromosome 7 open reading frame 53 (C7orf53), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review