C7orf53 (LSMEM1) (NM_182597) Human Recombinant Protein

CAT#: TP323802

Recombinant protein of human chromosome 7 open reading frame 53 (C7orf53), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified LSMEM1 protein (Cat# TP323802). The protein was produced from HEK293T cells transfected with LSMEM1 cDNA clone (Cat# RC223802) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC223802 representing NM_182597
  Red=Cloning site Green=Tags(s)
  
  MTHSSQDTGSCGIQEDGKLYVVDSINDLNKLNLCPAGSQHLFPLEDKIPVLGTNSGNGSRSLFFVGLLIV
  LIVSLALVFFVIFLIVQTGNKMDDVSRRLTAEGKDIDDLKRINNMIVKRLNQLNQLDSEQN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_872403
• Locus ID: 286006
• UniProt ID: Q8N8F7
• Cytogenetics: 7q31.1
• Refseq Size: 1691
• Refseq ORF: 393
• Synonyms: C7orf53
• Protein Families: Transmembrane