Deoxyribonuclease I like 1 (DNASE1L1) (NM_001009934) Human Recombinant Protein

CAT#: TP323658

Recombinant protein of human deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 4, 20 µg

Product Images

Coomassie blue staining of purified DNASE1L1 protein (Cat# TP323658). The protein was produced from HEK293T cells transfected with DNASE1L1 cDNA clone (Cat# RC223658) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC223658 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MHYPTALLFLILANGAQAFRICAFNAQRLTLAKVAREQVMDTLVRILARCDIMVLQEVVDSSGSAIPLLL
  RELNRFDGSGPYSTLSSPQLGRSTYMETYVYFYRSHKTQVLSSYVYNDEDDVFAREPFVAQFSLPSNVLP
  SLVLVPLHTTPKAVEKELNALYDVFLEVSQHWQSKDVILLGDFNADCASLTKKRLDKLELRTEPGFHWVI
  ADGEDTTVRASTHCTYDRVVLHGERCRSLLHTAAAFDFPTSFQLTEEEALNISDHYPVEVELKLSQAHSV
  QPLSLTVLLLLSLLSPQLCPAA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001009934
• Locus ID: 1774
• UniProt ID: P49184
• Cytogenetics: Xq28
• Refseq Size: 2665
• Refseq ORF: 906
• Synonyms: DNAS1L1; DNASEX; DNL1L; G4.8; XIB
• Summary: This gene encodes a deoxyribonuclease protein that shows high sequence similarity to DNase I. The encoded protein is localized to the endoplasmic reticulum and modified by N-linked glycosylation. Alternate transcriptional splice variants encoding the same protein have been observed. [provided by RefSeq, Jan 2015]