Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) (NM_001011725) Human Recombinant Protein

CAT#: TP323427

Recombinant protein of human heterogeneous nuclear ribonucleoprotein A1-like 2 (HNRNPA1L2), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified HNRNPA1L2 protein (Cat# TP323427). The protein was produced from HEK293T cells transfected with HNRNPA1L2 cDNA clone (Cat# RC223427) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC223427 representing NM_001011725
  Red=Cloning site Green=Tags(s)
  
  MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDA
  AMNTTPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDR
  GSGKKRGFAFVTFDDHDSVDKIVIQKYHTVKGHNCEVRKALPKQEMASASSSQRGRRGSGNFGGGRGDGF
  GGNDNFGRGGNFSGRGGFGGSCGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGN
  FGGRSSGPYGGGGQYFAKPQNQGGYGVSSSSSSYGSGRRF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001011725
• Locus ID: 144983
• UniProt ID: Q32P51, A0A024QZ98
• Cytogenetics: 13q14.3
• Refseq Size: 2224
• Refseq ORF: 960
• Summary: Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly(A) mRNA from the nucleus to the cytoplasm and may modulate splice site selection.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Spliceosome