SCN3B (NM_001040151) Human Recombinant Protein
CAT#: TP323114
Purified recombinant protein of Homo sapiens sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223114 protein sequence
Red=Cloning site Green=Tags(s) MPAFNRLFPLASLVLIYWVSVCFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGK DFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRL IPLRVTEEAGEDFTSVVSEIMMYILLVFLTLWLLIEMIYCYRKVSKAEEAAQENASDYLAIPSENKENSA VPVEE SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 22.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035241 |
Locus ID | 55800 |
UniProt ID | Q9NY72, A0A024R3H7 |
Cytogenetics | 11q24.1 |
Refseq Size | 5682 |
Refseq ORF | 645 |
Synonyms | ATFB16; BRGDA7; HSA243396; SCNB3 |
Summary | Voltage-gated sodium channels are transmembrane glycoprotein complexes composed of a large alpha subunit and one or more regulatory beta subunits. They are responsible for the generation and propagation of action potentials in neurons and muscle. This gene encodes one member of the sodium channel beta subunit gene family, and influences the inactivation kinetics of the sodium channel. Two alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Ion Channels: Sodium, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402676 | SCN3B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC421696 | SCN3B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC425685 | SCN3B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402676 | Transient overexpression lysate of sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 1 |
USD 436.00 |
|
LY421696 | Transient overexpression lysate of sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2 |
USD 436.00 |
|
LY425685 | Transient overexpression lysate of sodium channel, voltage-gated, type III, beta (SCN3B), transcript variant 2 |
USD 436.00 |
|
PH323114 | SCN3B MS Standard C13 and N15-labeled recombinant protein (NP_001035241) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review