plasticity related gene 3 (PLPPR1) (NM_207299) Human Recombinant Protein
CAT#: TP322205
Recombinant protein of human plasticity related gene 3 (PRG-3), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222205 protein sequence
Red=Cloning site Green=Tags(s) MAVGNNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYPGTEEESFITP LVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAQEKTILTGECCYLNPLLRRIIRFTGVFAFGLFATDI FVNAGQVVTGHLTPYFLTVCKPNYTSADCQAHHQFINNGNICTGDLEVIEKARRSFPSKHAALSIYSALY ATMYITSTIKTKSSRLAKPVLCLGTLCTAFLTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFK GTQGSPSKPKPEDPRGVPLMAFPRIESPLETLSAQNHSASMTEVT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_997182 |
Locus ID | 54886 |
UniProt ID | Q8TBJ4, A0A024R154 |
Cytogenetics | 9q31.1 |
Refseq Size | 2461 |
Refseq ORF | 975 |
Synonyms | LPPR1; PRG-3 |
Summary | This gene encodes a member of the plasticity-related gene (PRG) family. Members of the PRG family mediate lipid phosphate phosphatase activity in neurons and are known to be involved in neuronal plasticity. The protein encoded by this gene does not perform its function through enzymatic phospholipid degradation. This gene is strongly expressed in brain. It shows dynamic expression regulation during brain development and neuronal excitation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008] |
Protein Families | Phosphatase, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404081 | LPPR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC413579 | LPPR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY404081 | Transient overexpression lysate of lipid phosphate phosphatase-related protein type 1 (LPPR1), transcript variant 1 |
USD 436.00 |
|
LY413579 | Transient overexpression lysate of lipid phosphate phosphatase-related protein type 1 (LPPR1), transcript variant 2 |
USD 436.00 |
|
PH322205 | LPPR1 MS Standard C13 and N15-labeled recombinant protein (NP_997182) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review