CHN 1 (CHN1) (NM_001822) Human Recombinant Protein

CAT#: TP322163M

Recombinant protein of human chimerin (chimaerin) 1 (CHN1), transcript variant 1, 100 µg

Product Images

Coomassie blue staining of purified CHN1 protein (Cat# TP322163). The protein was produced from HEK293T cells transfected with CHN1 cDNA clone (Cat# RC222163) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC222163 representing NM_001822
  Red=Cloning site Green=Tags(s)
  
  MALTLFDTDEYRPPVWKSYLYQLQQEAPHPRRITCTCEVENRPKYYGREFHGMISREAADQLLIVAEGSY
  LIRESQRQPGTYTLALRFGSQTRNFRLYYDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTIN
  PIYEHVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKENEQIPKYEKIHNFKV
  HTFRGPHWCEYCANFMWGLIAQGVKCADCGLNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHTTK
  RPMVVDMCIREIESRGLNSEGLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDL
  PIPLITYDAYPKFIESAKIMDPDEQLETLHEALKLLPPAHCETLRYLMAHLKRVTLHEKENLMNAENLGI
  VFGPTLMRSPELDAMAALNDIRYQRLVVELLIKNEDILF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 53 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001813
• Locus ID: 1123
• UniProt ID: P15882
• Cytogenetics: 2q31.1
• Refseq Size: 2607
• Refseq ORF: 1377
• Synonyms: ARHGAP2; CHN; DURS2; NC; RHOGAP2
• Summary: This gene encodes GTPase-activating protein for ras-related p21-rac and a phorbol ester receptor. It is predominantly expressed in neurons, and plays an important role in neuronal signal-transduction mechanisms. Mutations in this gene are associated with Duane's retraction syndrome 2 (DURS2). Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Apr 2011]