EOLA1 (NM_178124) Human Recombinant Protein

CAT#: TP321372

Recombinant protein of human chromosome X open reading frame 40A (CXorf40A), 20 µg

Product Images

Coomassie blue staining of purified CXorf40A protein (Cat# TP321372). The protein was produced from HEK293T cells transfected with CXorf40A cDNA clone (Cat# RC221372) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221372 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDAWRELLVERLGMTPAQIQA
  LLRKGEKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAVLTNLKQKYLTVISNPRWLLEPIPRKGGK
  DVFQVDIPEHLIPLGHEV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_835225
• Locus ID: 91966
• UniProt ID: Q8TE69
• Cytogenetics: Xq28
• Refseq Size: 2436
• Refseq ORF: 474
• Synonyms: CXorf40; CXorf40A
• Summary: May have an important role of cell protection in inflammation reaction.[UniProtKB/Swiss-Prot Function]