EEF1B2 (NM_001959) Human Recombinant Protein

CAT#: TP321264

Recombinant protein of human eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 1, 20 µg

Product Images

Biolayer interferometry assays (BLI) of a biotinylated HIV RTp66/p51-loaded or integrase-loaded biosensor with 60 nM of purified eEF1A (OriGene TP309697), eEF1B (OriGene TP321264), eEF1D (OriGene TP303202), eEF1G (OriGene TP319578) or BSA as analytes. Figure cited from PLoS Pathog, PMID: 26624286

• 

  Coomassie blue staining of purified EEF1B2 protein (Cat# TP321264). The protein was produced from HEK293T cells transfected with EEF1B2 cDNA clone (Cat# RC221264) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221264 representing NM_001959
  Red=Cloning site Green=Tags(s)
  
  MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLP
  GVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKS
  SILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAF
  EDYVQSMDVAAFNKI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: Biolayer interferometry (BLI) assay (PMID: 26624286)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001950
• Locus ID: 1933
• UniProt ID: P24534, A0A024R3W7
• Cytogenetics: 2q33.3
• Refseq Size: 961
• Refseq ORF: 675
• Synonyms: EEF1B; EEF1B1; EF1B
• Summary: This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. [provided by RefSeq, Jul 2008]