Nucleobindin 2 (NUCB2) (NM_005013) Human Recombinant Protein

CAT#: TP320684

Purified recombinant protein of Homo sapiens nucleobindin 2 (NUCB2), 20 µg

Product Images

Coomassie blue staining of purified NUCB2 protein (Cat# TP320684). The protein was produced from HEK293T cells transfected with NUCB2 cDNA clone (Cat# RC220684) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC220684 representing NM_005013
  Red=Cloning site Green=Tags(s)
  
  MRWRTILLQYCFLLITCLLTALEAVPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKH
  FREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDELKRQEVGRLRMLIKAKLDSLQDIGMDHQALLKQFD
  HLNHLNPDKFESTDLDMLIKAATSDLEHYDKTRHEEFKKYEMMKEHERREYLKTLNEEKRKEEESKFEEM
  KKKHENHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNSDGFLDEQELEALFTKELEKVYDP
  KNEEDDMVEMEEERLRMREHVMNEVDTNKDRLVTLEEFLKATEKKEFLEPDSWETLDQQQFFTEEELKEY
  ENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIPPSGPAGELKFEPHI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 50 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005004
• Locus ID: 4925
• UniProt ID: P80303
• Cytogenetics: 11p15.1
• Refseq Size: 1612
• Refseq ORF: 1260
• Synonyms: HEL-S-109; NEFA
• Summary: This gene encodes a protein with a suggested role in calcium level maintenance, eating regulation in the hypothalamus, and release of tumor necrosis factor from vascular endothelial cells. This protein binds calcium and has EF-folding domains. [provided by RefSeq, Oct 2011]
• Protein Families: Secreted Protein, Transmembrane