VPS24 (CHMP3) (NM_016079) Human Recombinant Protein

CAT#: TP320006

Recombinant protein of human vacuolar protein sorting 24 homolog (S. cerevisiae) (VPS24), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified CHMP3 protein (Cat# TP320006). The protein was produced from HEK293T cells transfected with CHMP3 cDNA clone (Cat# RC220006) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC220006 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRS
  RKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGII
  EEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEAL
  EAMQSRLATLRS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057163
• Locus ID: 51652
• UniProt ID: Q9Y3E7
• Cytogenetics: 2p11.2
• Refseq Size: 3194
• Refseq ORF: 666
• Synonyms: CGI-149; NEDF; VPS24
• Summary: This gene encodes a protein that sorts transmembrane proteins into lysosomes/vacuoles via the multivesicular body (MVB) pathway. This protein, along with other soluble coiled-coil containing proteins, forms part of the ESCRT-III protein complex that binds to the endosomal membrane and recruits additional cofactors for protein sorting into the MVB. This protein may also co-immunoprecipitate with a member of the IFG-binding protein superfamily. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ring finger protein 103 (RNF103) gene. [provided by RefSeq, Nov 2010]
• Protein Pathways: Endocytosis