Galectin 10 (CLC) (NM_001828) Human Recombinant Protein

CAT#: TP319689M

Recombinant protein of human Charcot-Leyden crystal protein (CLC), 100 µg

Product Images

Coomassie blue staining of purified CLC protein (Cat# TP319689). The protein was produced from HEK293T cells transfected with CLC cDNA clone (Cat# RC219689) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC219689 representing NM_001828
  Red=Cloning site Green=Tags(s)
  
  MSLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYG
  AWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYL
  KR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001819
• Locus ID: 1178
• UniProt ID: Q05315
• Cytogenetics: 19q13.2
• Refseq Size: 641
• Refseq ORF: 426
• Synonyms: Gal-10; GAL10; LGALS10; LGALS10A; LPPL_HUMAN
• Summary: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene is a lysophospholipase expressed in eosinophils and basophils. It hydrolyzes lysophosphatidylcholine to glycerophosphocholine and a free fatty acid. This protein may possess carbohydrate or IgE-binding activities. It is both structurally and functionally related to the galectin family of beta-galactoside binding proteins. It may be associated with inflammation and some myeloid leukemias. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein