Thyrotropin Releasing Hormone (TRH) (NM_007117) Human Recombinant Protein

CAT#: TP319231

Recombinant protein of human thyrotropin-releasing hormone (TRH), 20 µg

Product Images

TRH enhances the survival and dendritic maintenance of SCA6 Purkinje cells. High-magnification images are L7+ Purkinje cells in green derived from control, heterozygous, and homozygous iPSCs on culture day 75 in the presence or absence of T3 and with or without TRH 1 (OriGene TP319231) or Riluzole. The scale bars represent 20 um. Figure cited from Cell Rep, PMID: 27806289

• 

  Coomassie blue staining of purified TRH protein (Cat# TP319231). The protein was produced from HEK293T cells transfected with TRH cDNA clone (Cat# RC219231) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC219231 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQRLQGDQGEHS
  ASQIFQSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRREDEASWSVDVTQHKRQHPGRR
  SPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLL
  GLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: Cell treatment (PMID: 27806289)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_009048
• Locus ID: 7200
• UniProt ID: P20396
• Cytogenetics: 3q22.1
• Refseq Size: 1890
• Refseq ORF: 726
• Synonyms: Pro-TRH; TRF
• Summary: This gene encodes a member of the thyrotropin-releasing hormone family. Cleavage of the encoded proprotein releases mature thyrotropin-releasing hormone, which is a tripeptide hypothalamic regulatory hormone. The human proprotein contains six thyrotropin-releasing hormone tripeptides. Thyrotropin-releasing hormone is involved in the regulation and release of thyroid-stimulating hormone, as well as prolactin. Deficiency of this hormone has been associated with hypothalamic hypothyroidism. [provided by RefSeq, May 2013]
• Protein Families: Druggable Genome, Secreted Protein