KTEL1 (POGLUT1) (NM_020231) Human Recombinant Protein

CAT#: TP319177

Recombinant protein of human KTEL (Lys-Tyr-Glu-Leu) containing 1 (KTELC1), 20 µg

Product Images

Coomassie blue staining of purified KTELC1 protein (Cat# TP319177). The protein was produced from HEK293T cells transfected with KTELC1 cDNA clone (Cat# RC219177) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC219177 representing NM_020231
  Red=Cloning site Green=Tags(s)
  
  MEWWASSPLRLWLLLFLLPSAQGRQKESGSKWKVFIDQINRSLENYEPCSSQNCSCYHGVIEEDLTPFRG
  GISRKMMAEVVRRKLGTHYQITKNRLYRENDCMFPSRCSGVEHFILEVIGRLPDMEMVINVRDYPQVPKW
  MEPAIPVFSFSKTSEYHDIMYPAWTFWEGGPAVWPIYPTGLGRWDLFREDLVRSAAQWPWKKKNSTAYFR
  GSRTSPERDPLILLSRKNPKLVDAEYTKNQAWKSMKDTLGKPAAKDVHLVDHCKYKYLFNFRGVAASFRF
  KHLFLCGSLVFHVGDEWLEFFYPQLKPWVHYIPVKTDLSNVQELLQFVKANDDVAQEIAERGSQFIRNHL
  QMDDITCYWENLLSEYSKFLSYNVTRRKGYDQIIPKMLKTEL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 46 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_064616
• Locus ID: 56983
• UniProt ID: Q8NBL1
• Cytogenetics: 3q13.33
• Refseq Size: 1973
• Refseq ORF: 1176
• Synonyms: CLP46, MDSRP, C3orf9, MDS010, hCLP46, KDELCL1, MGC32995
• Summary: This gene encodes a protein with both O-glucosyltransferase and O-xylosyltransferase activity which localizes to the lumen of the endoplasmic reticulum. This protein has a carboxy-terminal KTEL motif which is predicted to function as an endoplasmic reticulum retention signal. This gene is an essential regulator of Notch signalling and likely plays a role in cell fate and tissue formation during development. It may also play a role in the pathogenesis of leukemia. Mutations in this gene have been associated with the autosomal dominant genodermatosis Dowling-Degos disease 4. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]