Uridine Phosphorylase 1 (UPP1) (NM_181597) Human Recombinant Protein

CAT#: TP319125

Recombinant protein of human uridine phosphorylase 1 (UPP1), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified UPP1 protein (Cat# TP319125). The protein was produced from HEK293T cells transfected with UPP1 cDNA clone (Cat# RC219125) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC219125 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIR
  CVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLHELIKLLYYARCSNVTIIRIG
  TSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCT
  LDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQ
  ISSPRNVLSEYQQRPQRLVSYFIKKKLSKA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_853628
• Locus ID: 7378
• UniProt ID: Q16831
• Cytogenetics: 7p12.3
• Refseq Size: 1857
• Refseq ORF: 930
• Synonyms: UDRPASE; UP; UPASE; UPP
• Summary: This gene encodes a uridine phosphorylase, an enzyme that catalyzes the reversible phosphorylation of uridine (or 2'- deoxyuridine) to uracil and ribose-1-phosphate (or deoxyribose-1-phosphate). The encoded enzyme functions in the degradation and salvage of pyrimidine ribonucleosides. [provided by RefSeq, Oct 2016]
• Protein Pathways: Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism