FAM61B (LSM14B) (NM_144703) Human Recombinant Protein

CAT#: TP318487

Recombinant protein of human LSM14B, SCD6 homolog B (S. cerevisiae) (LSM14B), 20 µg

Product Images

Coomassie blue staining of purified LSM14B protein (Cat# TP318487). The protein was produced from HEK293T cells transfected with LSM14B cDNA clone (Cat# RC218487) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC218487 representing NM_144703
  Red=Cloning site Green=Tags(s)
  
  MSGSSGTPYLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPREEIYEYIIFR
  GSDIKDITVCEPPKAQHTLPQDPAIVQSSLGSASASPFQPHVPYSPFRGMAPYGPLAASSLLSQQYAASL
  GLGAGFPSIPVGKSPMVEQAVQTGSADNLNAKKLLPGKGTTGTQLNGRQAQPSSKTASDVVQPAAVQAQG
  QVNDENRRPQRRRSGNRRTRNRSRGQNRPTNVKENTIKFEGDFDFESANAQFNREELDKEFKKKLNFKDD
  KAEKGEEKDLAVVTQSAEAPAEEDLLGPNCYYDKSKSFFDNISSELKTSSRRTTWAEERKLNTETFGVSG
  RFLRGRSSRGGFRGGRGNGTTRRNPTSHRAGTGRV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 41.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_653304
• Locus ID: 149986
• UniProt ID: Q9BX40
• Cytogenetics: 20q13.33
• Refseq Size: 2618
• Refseq ORF: 1155
• Synonyms: bA11M20.3; C20orf40; FAM61B; FT005; LSM13; RAP55B
• Summary: May play a role in control of mRNA translation.[UniProtKB/Swiss-Prot Function]