NDUF3 (NDUFAF3) (NM_199070) Human Recombinant Protein

CAT#: TP317632

Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified NDUFAF3 protein (Cat# TP317632). The protein was produced from HEK293T cells transfected with NDUFAF3 cDNA clone (Cat# RC217632) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC217632 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATALALRSLYRARPSLRCPPVELPWAPRRGHRLSPADDELYQRTRISLLQREAAQAMYIDSYNSRGFMI
  NGNRVLGPCALLPHSVVQWNVGSHQDITEDSFSLFWLLEPRIEIVVVGTGDRTERLQSQVLQAMRQRGIA
  VEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_951033
• Locus ID: 25915
• UniProt ID: A4FU71, Q9Y3Z0
• Cytogenetics: 3p21.31
• Refseq Size: 950
• Refseq ORF: 555
• Synonyms: 2P1; C3orf60; E3-3; MC1DN18
• Summary: This gene encodes a mitochondrial complex I assembly protein that interacts with complex I subunits. Mutations in this gene cause mitochondrial complex I deficiency, a fatal neonatal disorder of the oxidative phosphorylation system. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2009]