Argininosuccinate Lyase (ASL) (NM_000048) Human Recombinant Protein
CAT#: TP317527
Recombinant protein of human argininosuccinate lyase (ASL), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217527 representing NM_000048
Red=Cloning site Green=Tags(s) MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKV AEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELI RTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLG VDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTG SSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVI STLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLF SGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 51.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000039 |
Locus ID | 435 |
UniProt ID | P04424, A0A024RDL8 |
Cytogenetics | 7q11.21 |
Refseq Size | 1937 |
Refseq ORF | 1392 |
Synonyms | ASAL |
Summary | This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Pathways | Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422562 | ASL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422563 | ASL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC422564 | ASL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC424953 | ASL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY422562 | Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 1 |
USD 436.00 |
|
LY422563 | Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 3 |
USD 665.00 |
|
LY422564 | Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 4 |
USD 665.00 |
|
LY424953 | Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 2 |
USD 665.00 |
|
PH301568 | ASL MS Standard C13 and N15-labeled recombinant protein (NP_001020114) |
USD 3,255.00 |
|
PH317527 | ASL MS Standard C13 and N15-labeled recombinant protein (NP_000039) |
USD 3,255.00 |
|
TP301568 | Recombinant protein of human argininosuccinate lyase (ASL), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review