Prostaglandin D Synthase (PTGDS) (NM_000954) Human Recombinant Protein

CAT#: TP316795SE

Purified recombinant protein of Human prostaglandin D2 synthase 21kDa (brain) (PTGDS), secretory expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified PTGDS protein (Cat #TP316795SE). The protein was produced from mammalian cells transfected with PTGDS cDNA clone (Cat #RC216795).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC216795 representing NM_000954
  Red=Cloning site Green=Tags(s)
  
  MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKAALSMCKSVVA
  PATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPG
  EDFRMATLYSRTQTPRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMTEQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.3 kDa
• Concentration: >50 ug/mL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000945
• Locus ID: 5730
• UniProt ID: P41222, A0A024R8G3
• Cytogenetics: 9q34.3
• Refseq Size: 837
• Refseq ORF: 570
• Synonyms: L-PGDS; LPGDS; PDS; PGD2; PGDS; PGDS2
• Summary: The protein encoded by this gene is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation. This gene is preferentially expressed in brain. Studies with transgenic mice overexpressing this gene suggest that this gene may be also involved in the regulation of non-rapid eye movement sleep. [provided by RefSeq, Jul 2008]
• Protein Pathways: Arachidonic acid metabolism, Metabolic pathways