METTL21D (VCPKMT) (NM_001040662) Human Recombinant Protein

CAT#: TP316594

Recombinant protein of human chromosome 14 open reading frame 138 (C14orf138), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified VCPKMT protein (Cat# TP316594). The protein was produced from HEK293T cells transfected with VCPKMT cDNA clone (Cat# RC216594) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC216594 representing NM_001040662
  Red=Cloning site Green=Tags(s)
  
  MADTLESSLEDPLRSFVRVLEKRDGTVLRLQQYSSGGVGCVVWDAAIVLSKYLETPEFSGDGAHALSRRS
  VLELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMNINMNKHLVTGSVQAKVLKWGEEIEGFPSPPDFI
  LMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFEKFPS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001035752
• Locus ID: 79609
• UniProt ID: Q9H867
• Cytogenetics: 14q21.3
• Refseq Size: 1679
• Refseq ORF: 582
• Synonyms: C14orf138; METTL21D; VCP-KMT
• Summary: Protein-lysine N-methyltransferase that specifically trimethylates 'Lys-315' of VCP/p97; this modification may decrease VCP ATPase activity.[UniProtKB/Swiss-Prot Function]