MAGIX (NM_024859) Human Recombinant Protein
CAT#: TP315910
Recombinant protein of human MAGI family member, X-linked (MAGIX), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215910 representing NM_024859
Red=Cloning site Green=Tags(s) MEPRTGGAANPKGSRGSRGPSPLAGPSARQLLARLDARPLAARAAVDVAALVRRAGATLRLRRKEAVSVL DSADIEVTDSRLPHATIVDHRPQHRWLETCNAPPQLIQGKARSAPKPSQASGHFSVELVRGYAGFGLTLG GGRDVAGDTPLAVRGLLKDGPAQRCGRLEVGDLVLHINGESTQGLTHAQAVERIRAGGPQLHLVIRRPLE THPGKPRGVGEPRKGVVPSWPDRSPDPGGPEVTGSRSSSTSLVQHPPSRTTLKKTRGSPEPSPEAAADGP TVSPPERRAEDPNDQIPGSPGPWLVPSEERLSRALGVRGAAQLAQEMAAGRRRH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079135 |
Locus ID | 79917 |
UniProt ID | Q9H6Y5 |
Cytogenetics | Xp11.23 |
Refseq Size | 2150 |
Refseq ORF | 1002 |
Synonyms | JM10; PDZX |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411025 | MAGIX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420494 | MAGIX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411025 | Transient overexpression lysate of MAGI family member, X-linked (MAGIX), transcript variant 1 |
USD 436.00 |
|
LY420494 | Transient overexpression lysate of MAGI family member, X-linked (MAGIX), transcript variant 4 |
USD 436.00 |
|
PH315846 | MAGIX MS Standard C13 and N15-labeled recombinant protein (NP_001093152) |
USD 3,255.00 |
|
PH315910 | MAGIX MS Standard C13 and N15-labeled recombinant protein (NP_079135) |
USD 3,255.00 |
|
TP315846 | Recombinant protein of human MAGI family member, X-linked (MAGIX), transcript variant 4, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review