Placental lactogen (CSH1) (NM_001317) Human Recombinant Protein

SKU
TP315860
Recombinant protein of human chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215860 protein sequence
Red=Cloning site Green=Tags(s)

MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSF
LHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLL
KDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRS
VEGSCGF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001308
Locus ID 1442
UniProt ID P0DML2
Cytogenetics 17q23.3
RefSeq Size 934
RefSeq ORF 651
Synonyms CS-1; CSA; CSMT; GHB3; hCS-1; hCS-A; PL
Summary The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Jak-STAT signaling pathway, Neuroactive ligand-receptor interaction
Write Your Own Review
You're reviewing:Placental lactogen (CSH1) (NM_001317) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH315860 CSH1 MS Standard C13 and N15-labeled recombinant protein (NP_001308) 10 ug
$3,255.00
LC411615 CSH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420012 CSH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411615 Transient overexpression lysate of chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1), transcript variant 2 100 ug
$436.00
LY420012 Transient overexpression lysate of chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.