C3orf37 (HMCES) (NM_020187) Human Recombinant Protein
CAT#: TP315567
Recombinant protein of human chromosome 3 open reading frame 37 (C3orf37), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215567 protein sequence
Red=Cloning site Green=Tags(s) MCGRTSCHLPRDVLTRACAYQDRRGQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERII APMRWGLVPSWFKESDPSKLQFNTTNCRSDTVMEKRSFKVPLGKGRRCVVLADGFYEWQRCQGTNQRQPY FIYFPQIKTEKSGSIGAADSPENWEKVWDNWRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIH HRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNSRNNTPECLAPVDLVVKKELRA SGSSQRMLQWLATKSPKKEDSKTPQKEESDVPQWSSQFLQKSPLPTKRGTAGLLEQWLKREKEEEPVAKR PYSQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_064572 |
Locus ID | 56941 |
UniProt ID | Q96FZ2 |
Cytogenetics | 3q21.3 |
Refseq Size | 1638 |
Refseq ORF | 1062 |
Synonyms | C3orf37; DC12; SRAPD1 |
Summary | Sensor of abasic sites in single-stranded DNA (ssDNA) required to preserve genome integrity by promoting error-free repair of abasic sites (PubMed:30554877). Acts as an enzyme that recognizes and binds abasic sites in ssDNA at replication forks and chemically modifies the lesion by forming a covalent cross-link with DNA (PubMed:30554877). The HMCES DNA-protein cross-link is then degraded by the proteasome (PubMed:30554877). Promotes error-free repair of abasic sites by acting as a 'suicide' enzyme that is degraded, thereby protecting abasic sites from translesion synthesis (TLS) polymerases and endonucleases that are error-prone and would generate mutations and double-strand breaks (PubMed:30554877). Acts as a protease: mediates autocatalytic processing of its N-terminal methionine in order to expose the catalytic cysteine (By similarity). Specifically binds 5-hydroxymethylcytosine (5hmC)-containing DNA in stem cells (By similarity). May act as an endonuclease that specifically cleaves 5hmC-containing DNA; additional experiments are however required to confirm this activity in vivo (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412609 | HMCES HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423676 | HMCES HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY412609 | Transient overexpression lysate of chromosome 3 open reading frame 37 (C3orf37), transcript variant 2 |
USD 436.00 |
|
LY423676 | Transient overexpression lysate of chromosome 3 open reading frame 37 (C3orf37), transcript variant 1 |
USD 436.00 |
|
PH308710 | C3orf37 MS Standard C13 and N15-labeled recombinant protein (NP_001006109) |
USD 3,255.00 |
|
PH315567 | C3orf37 MS Standard C13 and N15-labeled recombinant protein (NP_064572) |
USD 3,255.00 |
|
TP308710 | Recombinant protein of human chromosome 3 open reading frame 37 (C3orf37), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review