C19orf63 (EMC10) (NM_175063) Human Recombinant Protein

CAT#: TP315076

Recombinant protein of human chromosome 19 open reading frame 63 (C19orf63), transcript variant HSS1, 20 µg

Product Images

Coomassie blue staining of purified EMC10 protein (Cat# TP315076). The protein was produced from HEK293T cells transfected with EMC10 cDNA clone (Cat# RC215076) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC215076 representing NM_175063
  Red=Cloning site Green=Tags(s)
  
  MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRK
  RGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVES
  HLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQA
  QKAKNPQEQKSFFAKYWHIILGGAVLLTALRPAAPGPAPPPQEA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_778233
• Locus ID: 284361
• UniProt ID: Q5UCC4
• Cytogenetics: 19q13.33
• Refseq Size: 2740
• Refseq ORF: 762
• Synonyms: C19orf63; HSM1; HSS1
• Summary: Promotes angiogenesis and tissue repair in the heart after myocardial infarction. Stimulates cardiac endothelial cell migration and outgrowth via the activation of p38 MAPK, PAK and MAPK2 signaling pathways.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane