C19orf63 (EMC10) (NM_175063) Human Recombinant Protein
CAT#: TP315076
Recombinant protein of human chromosome 19 open reading frame 63 (C19orf63), transcript variant HSS1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215076 representing NM_175063
Red=Cloning site Green=Tags(s) MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRK RGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVES HLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQA QKAKNPQEQKSFFAKYWHIILGGAVLLTALRPAAPGPAPPPQEA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_778233 |
Locus ID | 284361 |
UniProt ID | Q5UCC4 |
Cytogenetics | 19q13.33 |
Refseq Size | 2740 |
Refseq ORF | 762 |
Synonyms | C19orf63; HSM1; HSS1 |
Summary | Promotes angiogenesis and tissue repair in the heart after myocardial infarction. Stimulates cardiac endothelial cell migration and outgrowth via the activation of p38 MAPK, PAK and MAPK2 signaling pathways.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406303 | EMC10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406303 | Transient overexpression lysate of chromosome 19 open reading frame 63 (C19orf63), transcript variant HSS1 |
USD 436.00 |
|
PH315076 | C19orf63 MS Standard C13 and N15-labeled recombinant protein (NP_778233) |
USD 3,255.00 |
|
TP700056 | Recombinant protein of secreted form of human HSS1 with DDK/His tag, expressed in human cells, 20ug |
USD 867.00 |
|
TP760930 | Purified recombinant protein of Human chromosome 19 open reading frame 63 (C19orf63), transcript variant HSS1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review