C6orf35 (TMEM242) (NM_018452) Human Recombinant Protein
CAT#: TP312992
Recombinant protein of human chromosome 6 open reading frame 35 (C6orf35), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212992 protein sequence
Red=Cloning site Green=Tags(s) METAGAATGQPASGLEAPGSTNDRLFLVKGGIFLGTVAAAGMLAGFITTLSLAKKKSPEWFNKGSMATAA LPESGSSLALRALGWGSLYAWCGVGVISFAVWKALGVHSMNDFRSKMQSIFPTIPKNSESAVEWEETLKS K myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060922 |
Locus ID | 729515 |
UniProt ID | Q9NWH2 |
Cytogenetics | 6q25.3 |
Refseq Size | 5084 |
Refseq ORF | 423 |
Synonyms | BM033; C6orf35 |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413032 | TMEM242 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413032 | Transient overexpression lysate of chromosome 6 open reading frame 35 (C6orf35) |
USD 436.00 |
|
PH312992 | C6orf35 MS Standard C13 and N15-labeled recombinant protein (NP_060922) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review