CTNNBIP1 (NM_001012329) Human Recombinant Protein

CAT#: TP312922

Recombinant protein of human catenin, beta interacting protein 1 (CTNNBIP1), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified CTNNBIP1 protein (Cat# TP312922). The protein was produced from HEK293T cells transfected with CTNNBIP1 cDNA clone (Cat# RC212922) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212922 representing NM_001012329
  Red=Cloning site Green=Tags(s)
  
  MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMA
  FSRSETEDRRQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001012329
• Locus ID: 56998
• UniProt ID: Q9NSA3, A0A024R4D7
• Cytogenetics: 1p36.22
• Refseq Size: 2961
• Refseq ORF: 243
• Synonyms: ICAT
• Summary: The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Wnt signaling pathway