SLURP1 (NM_020427) Human Recombinant Protein

CAT#: TP311275

Recombinant protein of human secreted LY6/PLAUR domain containing 1 (SLURP1), 20 µg

Product Images

Coomassie blue staining of purified SLURP1 protein (Cat# TP311275). The protein was produced from HEK293T cells transfected with SLURP1 cDNA clone (Cat# RC211275) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC211275 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVT
  RSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_065160
• Locus ID: 57152
• UniProt ID: P55000
• Cytogenetics: 8q24.3
• Refseq Size: 537
• Refseq ORF: 309
• Synonyms: ANUP; ARS; ArsB; LY6-MT; LY6LS; MDM
• Summary: The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Secreted Protein