Tyrosine Hydroxylase (TH) (NM_000360) Human Recombinant Protein

CAT#: TP311218

Recombinant protein of human tyrosine hydroxylase (TH), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified TH protein (Cat# TP311218). The protein was produced from HEK293T cells transfected with TH cDNA clone (Cat# RC211218) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >Peptide sequence encoded by RC211218
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MPTPDATTPQAKGFRRAVSELDAKQAEAIMSPRFIGRRQSLIEDARKEREAAVAAVAAAVPSEPGDPLE
  AVAFEEKEGKAMLNLLFSPRATKPSALSRAVKVFETFEAKIHHLETRPAQRPRAGGPHLEYFVRLEVRR
  GDLAALLSGVRQVSEDVRSPAGPKVPWFPRKVSELDKCHHLVTKFDPDLDLDHPGFSDQVYRQRRKLIA
  EIAFQYRHGDPIPRVEYTAEEIATWKEVYTTLKGLYATHACGEHLEAFALLERFSGYREDNIPQLEDVS
  RFLKERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASSPMHSPEPDCCHELLGHVPMLADRTFA
  QFSQDIGLASLGASDEEIEKLSTLYWFTVEFGLCKQNGEVKAYGAGLLSSYGELLHCLSEEPEIRAFDP
  EAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQ
  DELDTLAHALSAIG
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
  
  Recombinant protein using RC211218 also available, TP311218M
• Tag: C-Myc/DDK
• Predicted MW: 55.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000351
• Locus ID: 7054
• UniProt ID: P07101
• Cytogenetics: 11p15.5
• Refseq Size: 1817
• Refseq ORF: 1491
• Synonyms: DYT5b; DYT14; TYH
• Summary: The protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Parkinson's disease, Tyrosine metabolism