WNT16 (NM_057168) Human Recombinant Protein
CAT#: TP311204
Purified recombinant protein of Homo sapiens wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211204 representing NM_057168
Red=Cloning site Green=Tags(s) MDRAALLGLARLCALWAALLVLFPYGAQGNWMWLGIASFGVPEKLGCANLPLNSRQKELCKRKPYLLPSI REGARLGIQECGSQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKETAFIYAVMAAGLVHSVTRSCS AGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSRKFLDFPIGNTTGKENKVLLAMNLHNNEAGR QAVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQISDKTKRKMRRREKDQRKIPIH KDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYV RCRRCESMTDVHTCK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_476509 |
Locus ID | 51384 |
UniProt ID | Q9UBV4 |
Cytogenetics | 7q31.31 |
Refseq Size | 3132 |
Refseq ORF | 1095 |
Summary | The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It contains two transcript variants diverging at the 5' termini. These two variants are proposed to be the products of separate promoters and not to be splice variants from a single promoter. They are differentially expressed in normal tissues, one of which (variant 2) is expressed at significant levels only in the pancreas, whereas another one (variant 1) is expressed more ubiquitously with highest levels in adult kidney, placenta, brain, heart, and spleen. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein, Transmembrane |
Protein Pathways | Basal cell carcinoma, Hedgehog signaling pathway, Melanogenesis, Pathways in cancer, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409269 | WNT16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC414193 | WNT16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY409269 | Transient overexpression lysate of wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 1 |
USD 436.00 |
|
LY414193 | Transient overexpression lysate of wingless-type MMTV integration site family, member 16 (WNT16), transcript variant 2 |
USD 436.00 |
|
PH311204 | WNT16 MS Standard C13 and N15-labeled recombinant protein (NP_476509) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review