LECT2 (NM_002302) Human Recombinant Protein

CAT#: TP310790SE

Purified recombinant protein of Human leukocyte cell-derived chemotaxin 2 (LECT2), secretory expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified LECT2 protein (Cat #TP310790SE). The protein was produced from mammalian cells transfected with LECT2 cDNA clone (Cat #RC210790).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210790 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDVLCSAGSTVYAPF
  TGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIE
  NCDSSDPTAYL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.2 kDa
• Concentration: >50 ug/mL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002293
• Locus ID: 3950
• UniProt ID: O14960
• Cytogenetics: 5q31.1
• Refseq Size: 1077
• Refseq ORF: 453
• Synonyms: chm-II; chm2
• Summary: This gene encodes a secreted, 16 kDa protein that acts as a chemotactic factor to neutrophils and stimulates the growth of chondrocytes and osteoblasts. This protein has high sequence similarity to the chondromodulin repeat regions of the chicken myb-induced myeloid 1 protein. A polymorphism in this gene may be associated with rheumatoid arthritis. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Secreted Protein