C4orf46 (NM_001008393) Human Recombinant Protein

  • Product Brand Image
SKU
TP310526
Recombinant protein of human chromosome 4 open reading frame 46 (C4orf46), 20 µg
In Control Promo
  $867.00
4 Weeks*
Bulk/Customize
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210526 protein sequence
Red=Cloning site Green=Tags(s)

MADPEELQVSSPPPPPPSSPSSSDASAASSPGGPVSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKL
LEATSAVSAQVEELAFKCTENARFLKTWRDLLKEGYDSLKPDD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001008394
Locus ID 201725
UniProt ID Q504U0
Cytogenetics 4q32.1
RefSeq Size 3545
RefSeq ORF 339
Synonyms RCDG1
Summary This gene encodes a small, conserved protein of unknown function that is expressed in a variety of tissues. There are pseudogenes for this gene on chromosomes 6, 8, 16, and X. Alternative splicing results in multiple transcript variants. provided by RefSeq, Feb 2013
Protein Categories Intracellular Proteins
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "C4orf46" proteins (3)
SKU Description Size Price
PH310526 C4orf46 MS Standard C13 and N15-labeled recombinant protein (NP_001008394) 10 ug
$3,360.00
LC423420 C4orf46 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY423420 Transient overexpression lysate of chromosome 4 open reading frame 46 (C4orf46) 100 ug
$436.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.