GNG10 (NM_001017998) Human Recombinant Protein

CAT#: TP310455

Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 10 (GNG10), 20 µg

Product Images

Coomassie blue staining of purified GNG10 protein (Cat# TP310455). The protein was produced from HEK293T cells transfected with GNG10 cDNA clone (Cat# RC210455) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210455 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001017998
• Locus ID: 2790
• UniProt ID: P50151, A0A024R156
• Cytogenetics: 9q31.3
• Refseq Size: 1269
• Refseq ORF: 204
• Summary: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Interacts with beta-1 and beta-2, but not with beta-3.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway