alpha 5 Defensin (DEFA5) (NM_021010) Human Recombinant Protein

CAT#: TP310219SE

Purified recombinant protein of Human defensin, alpha 5, Paneth cell-specific (DEFA5), secretory expressed in HEK293T cells, 20ug


Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

USD 867.00

2 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00


Rabbit Polyclonal Anti-DEFA5 Antibody
    • 100 ul

USD 380.00

Other products for "alpha 5 Defensin"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC210219 protein sequence
Red=Cloning site Green=Tags(s)

MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTG
RCATRESLSGVCEISGRLYRLCCR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11.7 kDa
Concentration >50 ug/mL as determined by microplate Bradford method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_066290
Locus ID 1670
UniProt ID Q01523
Cytogenetics 8p23.1
Refseq Size 468
Refseq ORF 282
Synonyms DEF5; HD-5
Summary Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several of the alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 5, is highly expressed in the secretory granules of Paneth cells of the ileum. [provided by RefSeq, Oct 2014]
Protein Families Secreted Protein

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.