alpha 5 Defensin (DEFA5) (NM_021010) Human Recombinant Protein

CAT#: TP310219SE

Purified recombinant protein of Human defensin, alpha 5, Paneth cell-specific (DEFA5), secretory expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified DEFA5 protein (Cat #TP310219SE). The protein was produced from mammalian cells transfected with DEFA5 cDNA clone (Cat #RC210219).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210219 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTG
  RCATRESLSGVCEISGRLYRLCCR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.7 kDa
• Concentration: >50 ug/mL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_066290
• Locus ID: 1670
• UniProt ID: Q01523
• Cytogenetics: 8p23.1
• Refseq Size: 468
• Refseq ORF: 282
• Synonyms: DEF5; HD-5
• Summary: Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several of the alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 5, is highly expressed in the secretory granules of Paneth cells of the ileum. [provided by RefSeq, Oct 2014]
• Protein Families: Secreted Protein