CYP4F22 (NM_173483) Human Recombinant Protein
CAT#: TP310185L
Recombinant protein of human cytochrome P450, family 4, subfamily F, polypeptide 22 (CYP4F22), 1 mg
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Frequently bought together (2)
Other products for "CYP4F22"
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210185 protein sequence
Red=Cloning site Green=Tags(s) MLPITDRLLHLLGLEKTAFRIYAVSTLLLFLLFFLFRLLLRFLRLCRSFYITCRRLRCFPQPPRRNWLLG HLGMYLPNEAGLQDEKKVLDNMHHVLLVWMGPVLPLLVLVHPDYIKPLLGASAAIAPKDDLFYGFLKPWL GDGLLLSKGDKWSRHRRLLTPAFHFDILKPYMKIFNQSADIMHAKWRHLAEGSAVSLDMFEHISLMTLDS LQKCVFSYNSNCQEKMSDYISAIIELSALSVRRQYRLHHYLDFIYYRSADGRRFRQACDMVHHFTTEVIQ ERRRALRQQGAEAWLKAKQGKTLDFIDVLLLARDEDGKELSDEDIRAEADTFMFEGHDTTSSGISWMLFN LAKYPEYQEKCREEIQEVMKGRELEELEWDDLTQLPFTTMCIKESLRQYPPVTLVSRQCTEDIKLPDGRI IPKGIICLVSIYGTHHNPTVWPDSKVYNPYRFDPDNPQQRSPLAYVPFSAGPRNCIGQSFAMAELRVVVA LTLLRFRLSVDRTRKVRRKPELILRTENGLWLKVEPLPPRA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 61.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_775754 |
Locus ID | 126410 |
UniProt ID | Q6NT55 |
Cytogenetics | 19p13.12 |
Refseq Size | 2620 |
Refseq ORF | 1593 |
Synonyms | ARCI5; INLNE; LI3 |
Summary | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This gene is part of a cluster of cytochrome P450 genes on chromosome 19 and encodes an enzyme thought to play a role in the 12(R)-lipoxygenase pathway. Mutations in this gene are the cause of ichthyosis lamellar type 3. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.