PWWP domain containing protein 2B (PWWP2B) (NM_138499) Human Recombinant Protein

SKU
TP309863
Recombinant protein of human PWWP domain containing 2B (PWWP2B), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209863 protein sequence
Red=Cloning site Green=Tags(s)

MQLGSSSPPPACGVQPPETTGPEPPPPLVPPLPAGSLPPYPPYFEGAPFPHPLWLRDTYKLWVPQPPPRT
IKRTRRRLSRNRDPGRLILSTIRLRPRQVLCEKCKSTLSPPEASPGPPAAPRARRRLGSGPDRELRKPEE
PENGEPTAAATARRSKRERREEDRAPAEQVPRSPVIKISYSTPQGKGEVVKIPSRVHGSLEPFRPQQAPQ
DDGSQDPEVLDRESRDRPSCAPSASIPKLKLTRPVPAGADLPPPKIRLKPHRLGDSEHEPVYRAELVGEL
NGYLRDSSPAPCADGPAGGLADLSSGSSGEDDDFKSCPQGPQGREGLAFLVSCPEGRADCASESACSSDS
LDEARSSGSEGTPADTGDLSPGHGASAPSVSREARQTVPPLTVRLHTQSVSECITEDGRTVAVGDIVWGK
IHGFPWWPARVLDISLGQKEDGEPSWREAKVSWFGSPTTSFLSISKLSPFSEFFKLRFNRKKKGMYRKAI
TEAANAARHVAPEIRELLTQFET

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 63.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_612508
Locus ID 170394
UniProt ID Q6NUJ5
Cytogenetics 10q26.3
RefSeq Size 2626
RefSeq ORF 1539
Synonyms bA432J24.1; pp8607; PWWP2
Write Your Own Review
You're reviewing:PWWP domain containing protein 2B (PWWP2B) (NM_138499) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309863 PWWP2B MS Standard C13 and N15-labeled recombinant protein (NP_612508) 10 ug
$3,255.00
LC408588 PWWP2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420659 PWWP2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408588 Transient overexpression lysate of PWWP domain containing 2B (PWWP2B), transcript variant 1 100 ug
$436.00
LY420659 Transient overexpression lysate of PWWP domain containing 2B (PWWP2B), transcript variant 2 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.