TIMP2 (NM_003255) Human Recombinant Protein

CAT#: TP309796M

Recombinant protein of human TIMP metallopeptidase inhibitor 2 (TIMP2), 100 µg

Product Images

Coomassie blue staining of purified TIMP2 protein (Cat# TP309796). The protein was produced from HEK293T cells transfected with TIMP2 cDNA clone (Cat# RC209796) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209796 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQ
  YEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQ
  KKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPP
  KQEFLDIEDP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003246
• Locus ID: 7077
• UniProt ID: P16035, A0A140VK57
• Cytogenetics: 17q25.3
• Refseq Size: 3670
• Refseq ORF: 660
• Synonyms: CSC-21K; DDC8
• Summary: This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Secreted Protein