ZNF313 (RNF114) (NM_018683) Human Recombinant Protein

CAT#: TP309752

Recombinant protein of human ring finger protein 114 (RNF114), 20 µg

Product Images

Coomassie blue staining of purified RNF114 protein (Cat# TP309752). The protein was produced from HEK293T cells transfected with RNF114 cDNA clone (Cat# RC209752) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209752 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAQQRDCGGAAQLAGPAAEADPLGRFTCPVCLEVYEKPVQVPCGHVFCSACLQECLKPKKPVCGVCRSA
  LAPGVRAVELERQIESTETSCHGCRKNFFLSKIRSHVATCSKYQNYIMEGVKATIKDASLQPRNVPNRYT
  FPCPYCPEKNFDQEGLVEHCKLFHSTDTKSVVCPICASMPWGDPNYRSANFREHIQRRHRFSYDTFVDYD
  VDEEDMMNQVLQRSIIDQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_061153
• Locus ID: 55905
• UniProt ID: Q9Y508
• Cytogenetics: 20q13.13
• Refseq Size: 2478
• Refseq ORF: 684
• Synonyms: PSORS12; ZNF313
• Summary: E3 ubiquitin-protein ligase promoting the ubiquitination and degradation of the CDK inhibitor CDKN1A and probably also CDKN1B and CDKN1C. These activities stimulate cell cycle's G1-to-S phase transition and suppress cellular senescence. May play a role in spermatogenesis.[UniProtKB/Swiss-Prot Function]