TCP10 (NM_004610) Human Recombinant Protein

  • Product Brand Image
SKU
TP309558
Recombinant protein of human t-complex 10 homolog (mouse) (TCP10), 20 µg
  $867.00
4 Weeks*
Bulk/Customize
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209558 protein sequence
Red=Cloning site Green=Tags(s)

MLEGQLEAGEPKEGTHPEDPCPGAGAAMEKTPAAAEVPREDGNAEEMPSLQQQITSLHQELGRQQSLWAD
IHRKLQSHMDALRKQNRELREELRGLQRQQWEAGKKPAASPHAGRESHTLALEPAFGKISPLSADEETTP
KYAGRKSQSATLLGQRWSSNHLAPPKPMSLKTERINSGKTPPQEDREKSPPGRRQDRSPAPTGRPTPGAE
RREVSEDGKIMHPSSRSPQNSGGRKSPVQASQATTLQEQTAAARGADRSSSVLGSSEGGFLSRVQADEFA
SSSPDSAERQNLPVNPPSSLEIAQAMDTKMKKEEVQEEKRHPKGKADDCRRSGFPSEFPGALHAAPSRQD
MGP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004601
Locus ID 6953
UniProt ID Q12799
Cytogenetics 6q27
RefSeq Size 1273
RefSeq ORF 1059
Synonyms TCP10A
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "TCP10" proteins (3)
SKU Description Size Price
PH309558 TCP10 MS Standard C13 and N15-labeled recombinant protein (NP_004601) 10 ug
$3,360.00
LC417872 TCP10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417872 Transient overexpression lysate of t-complex 10 homolog (mouse) (TCP10) 100 ug
$436.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.