RGS20 (NM_003702) Human Recombinant Protein

CAT#: TP309495

Recombinant protein of human regulator of G-protein signaling 20 (RGS20), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified RGS20 protein (Cat# TP309495). The protein was produced from HEK293T cells transfected with RGS20 cDNA clone (Cat# RC209495) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209495 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCS
  CSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEE
  NMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIY
  TLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003693
• Locus ID: 8601
• UniProt ID: O76081, H9NIM5, B3KSW4
• Cytogenetics: 8q11.23
• Refseq Size: 1716
• Refseq ORF: 723
• Synonyms: g(z)GAP; gz-GAP; RGSZ1; ZGAP1
• Summary: The protein encoded by this gene belongs to the family of regulator of G protein signaling (RGS) proteins, which are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins inhibit signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound forms. This protein selectively binds to G(z)-alpha and G(alpha)-i2 subunits, and regulates their signaling activities. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]
• Protein Families: Druggable Genome