LCN1 (NM_002297) Human Recombinant Protein

CAT#: TP309363SE

Purified recombinant protein of Human lipocalin 1 (tear prealbumin) (LCN1), secretory expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified LCN1 protein (Cat #TP309363SE). The protein was produced from mammalian cells transfected with LCN1 cDNA clone (Cat #RC209363).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209363 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAK
  VTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKN
  NLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.0 kDa
• Concentration: >50 ug/mL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002288
• Locus ID: 3933
• UniProt ID: P31025, A0A024R8D7
• Cytogenetics: 9q34.3
• Refseq Size: 789
• Refseq ORF: 528
• Synonyms: PMFA; TLC; TP; VEGP
• Summary: This gene encodes a member of the lipocalin family of small secretory proteins. Lipocalins are extracellular transport proteins that bind to a variety of hydrophobic ligands. The encoded protein is the primary lipid binding protein in tears and is overproduced in response to multiple stimuli including infection and stress. The encoded protein may be a marker for chromosome aneuploidy as well as an autoantigen in Sjogren's syndrome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and two pseudogenes of this gene are also located on the long arm of chromosome 9. [provided by RefSeq, Nov 2011]
• Protein Families: Secreted Protein