LIPG (NM_006033) Human Recombinant Protein

CAT#: TP309248SE

Purified recombinant protein of Human lipase, endothelial (LIPG), secretory expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified LIPG protein (Cat #TP309248SE). The protein was produced from mammalian cells transfected with LIPG cDNA clone (Cat #RC209248).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >Peptide sequence encoded by RC209248
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MSNSVPLLCFWSLCYCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPEHEGCYLSVG
  HSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNT
  RVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFEGADIHKR
  LSPDDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGGDFQPGCGLNDVLGSIAYGTITEVVKCEHER
  AVHLFVDSLVNQDKPSFAFQCTDSNRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPFR
  VYHYQMKIHVFSYKNMGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLVYTEEDLGDLLKIQL
  TWEGASQSWYNLWKEFRSYLSQPRNPGRELNIRRIRVKSGETQRKLTFCTEDPENTSISPGQELWFRKC
  RDGWRMKNETSPTVELP
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
  
  Recombinant protein using RC209248 also available, TP309248
• Tag: C-Myc/DDK
• Predicted MW: 58.4 kDa
• Concentration: >50 ug/mL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006024
• Locus ID: 9388
• UniProt ID: Q9Y5X9, A0A024R2B5
• Cytogenetics: 18q21.1
• Refseq Size: 4143
• Refseq ORF: 1500
• Synonyms: EDL; EL; PRO719
• Summary: The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Glycerolipid metabolism, Metabolic pathways