PTPN5 (NM_006906) Human Recombinant Protein
CAT#: TP308953
Recombinant protein of human protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) (PTPN5), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208953 protein sequence
Red=Cloning site Green=Tags(s) MNYEGARSERENHAADDSEGGALDMCCSERLPGLPQPIVMEALDEAEGLQDSQREMPPPPPPSPPSDPAQ KPPPRGAGSHSLTVRSSLCLFAASQFLLACGVLWFSGYGHIWSQNATNLVSSLLTLLKQLEPTAWLDSGT WGVPSLLLVFLSVGLVLVTTLVWHLLRTPPEPPTPLPPEDRRQSVSRQPSFTYSEWMEEKIEDDFLDLDP VPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLS ASRVLQAEELHEKALDPFLLQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPL SSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYD GVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCA PIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLYEKQLS HQSPE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 63.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_008837 |
Locus ID | 84867 |
UniProt ID | P54829, Q86TL3 |
Cytogenetics | 11p15.1 |
Refseq Size | 3201 |
Refseq ORF | 1695 |
Synonyms | PTPSTEP; STEP; STEP61 |
Summary | May regulate the activity of several effector molecules involved in synaptic plasticity and neuronal cell survival, including MAPKs, Src family kinases and NMDA receptors.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Phosphatase, Transmembrane |
Protein Pathways | MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403199 | PTPN5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC416327 | PTPN5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC421867 | PTPN5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC429321 | PTPN5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403199 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) (PTPN5), transcript variant 2 |
USD 436.00 |
|
LY416327 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) (PTPN5), transcript variant 1 |
USD 436.00 |
|
LY421867 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) (PTPN5), transcript variant 3 |
USD 665.00 |
|
LY429321 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) (PTPN5), transcript variant 1 |
USD 436.00 |
|
PH308953 | PTPN5 MS Standard C13 and N15-labeled recombinant protein (NP_008837) |
USD 3,255.00 |
|
PH317371 | PTPN5 MS Standard C13 and N15-labeled recombinant protein (NP_116170) |
USD 3,255.00 |
|
TP317371 | Recombinant protein of human protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) (PTPN5), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review