AGR3 (NM_176813) Human Recombinant Protein

CAT#: TP308897M

Recombinant protein of human anterior gradient homolog 3 (Xenopus laevis) (AGR3), 100 µg

Product Images

Coomassie blue staining of purified AGR3 protein (Cat# TP308897). The protein was produced from HEK293T cells transfected with AGR3 cDNA clone (Cat# RC208897) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208897 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLED
  CQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRL
  YTYEPRDLPLLIENMKKALRLIQSEL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_789783
• Locus ID: 155465
• UniProt ID: Q8TD06
• Cytogenetics: 7p21.1
• Refseq Size: 763
• Refseq ORF: 498
• Synonyms: AG-3; AG3; BCMP11; hAG-3; HAG3; PDIA18
• Summary: This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This gene is expressed in ciliated airway epithelial cells and, in mouse, plays a role in ciliary beat frequency in multiciliated cells. This gene is also over-expressed in breast, ovarian, and prostrate cancers. [provided by RefSeq, Dec 2016]
• Protein Families: Secreted Protein