OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

14-3-3 theta (YWHAQ) (NM_006826) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308646
Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA322463 Anti-YWHAQ Rabbit Polyclonal Antibody
100 ul
$305.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "14-3-3 theta or NM_006826"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208646 protein sequence
Red=Cloning site Green=Tags(s)

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTD
TSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQ
TIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDS
YKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006817
Locus ID 10971
UniProt ID P27348
Cytogenetics 2p25.1
RefSeq Size 2272
RefSeq ORF 735
Synonyms 1C5; 14-3-3; HS1
Summary This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5' UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis, Pathogenic Escherichia coli infection
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "14-3-3 theta" proteins (3)
SKU Description Size Price
PH308646 YWHAQ MS Standard C13 and N15-labeled recombinant protein (NP_006817) 10 ug
$3,360.00
LC416397 Lyophilized YWHAQ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416397 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products