TRP1 (TYRP1) (NM_000550) Human Recombinant Protein

CAT#: TP308595

Recombinant protein of human tyrosinase-related protein 1 (TYRP1), 20 µg

Product Images

Coomassie blue staining of purified TYRP1 protein (Cat# TP308595). The protein was produced from HEK293T cells transfected with TYRP1 cDNA clone (Cat# RC208595) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208595 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSAPKLLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTA
  DSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEE
  KNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGE
  VDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPN
  SVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSN
  STNSFRNTVEGYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNA
  DISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSREFSVPEIIAIAVVGALLLV
  ALIFGTASYLIRARRSMDEANQPLLTDQYQCYAEEYEKLQNPNQSVV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 58 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000541
• Locus ID: 7306
• UniProt ID: P17643
• Cytogenetics: 9p23
• Refseq Size: 2876
• Refseq ORF: 1611
• Synonyms: b-PROTEIN; CAS2; CATB; GP75; OCA3; TRP; TRP1; TYRP
• Summary: This gene encodes a melanosomal enzyme that belongs to the tyrosinase family and plays an important role in the melanin biosynthetic pathway. Defects in this gene are the cause of rufous oculocutaneous albinism and oculocutaneous albinism type III. [provided by RefSeq, Mar 2009]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Melanogenesis, Metabolic pathways, Tyrosine metabolism