MAPKAP Kinase 2 (MAPKAPK2) (NM_032960) Human Recombinant Protein

SKU
TP308563
Recombinant protein of human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208563 representing NM_032960
Red=Cloning site Green=Tags(s)

MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVL
GLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMEC
LDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGF
AKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIR
MGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWE
DVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 45.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_116584
Locus ID 9261
UniProt ID P49137
Cytogenetics 1q32.1
RefSeq Size 3071
RefSeq ORF 1200
Synonyms MAPKAP-K2; MK-2; MK2
Summary This gene encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways MAPK signaling pathway, Neurotrophin signaling pathway, VEGF signaling pathway
 
 
 
 
 
Be the first to review this product
SKU Description Size Price
PH308563 MAPKAPK2 MS Standard C13 and N15-labeled recombinant protein (NP_116584) 10 ug
$3,255.00
PH320487 MAPKAPK2 MS Standard C13 and N15-labeled recombinant protein (NP_004750) 10 ug
$3,255.00
LC409844 MAPKAPK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417772 MAPKAPK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409844 Transient overexpression lysate of mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 2 100 ug
$436.00
LY417772 Transient overexpression lysate of mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 1 100 ug
$436.00
TP320487 Recombinant protein of human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.