COA5 (NM_001008215) Human Recombinant Protein

CAT#: TP308299

Recombinant protein of human chromosome 2 open reading frame 64 (C2orf64), 20 µg

Product Images

Coomassie blue staining of purified COA5 protein (Cat# TP308299). The protein was produced from HEK293T cells transfected with COA5 cDNA clone (Cat# RC208299) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208299 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFRG
  RKGY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001008216
• Locus ID: 493753
• UniProt ID: Q86WW8
• Cytogenetics: 2q11.2
• Refseq Size: 1767
• Refseq ORF: 222
• Synonyms: 6330578E17Rik; C2orf64; CEMCOX3; MC4DN9; Pet191
• Summary: This gene encodes an ortholog of yeast Pet191, which in yeast is a subunit of a large oligomeric complex associated with the mitochondrial inner membrane, and required for the assembly of the cytochrome c oxidase complex. Mutations in this gene are associated with mitochondrial complex IV deficiency, a disorder of the mitochondrial respiratory chain with heterogeneous clinical manifestations, ranging from isolated myopathy to a severe disease affecting several tissues and organs. [provided by RefSeq, Dec 2011]