UBC3B (UBE2R2) (NM_017811) Human Recombinant Protein

CAT#: TP307977

Recombinant protein of human ubiquitin-conjugating enzyme E2R 2 (UBE2R2), 20 µg

Product Images

Coomassie blue staining of purified UBE2R2 protein (Cat# TP307977). The protein was produced from HEK293T cells transfected with UBE2R2 cDNA clone (Cat# RC207977) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207977 representing NM_017811
  Red=Cloning site Green=Tags(s)
  
  MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPY
  SPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPA
  NVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDL
  YDDDIDDEDEEEEDADCYDDDDSGNEES
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060281
• Locus ID: 54926
• UniProt ID: Q712K3
• Cytogenetics: 9p13.3
• Refseq Size: 4457
• Refseq ORF: 714
• Synonyms: CDC34B; E2-CDC34B; UBC3B
• Summary: Protein kinase CK2 is a ubiquitous and pleiotropic Ser/Thr protein kinase involved in cell growth and transformation. This gene encodes a protein similar to the E2 ubiquitin conjugating enzyme UBC3/CDC34. Studies suggest that CK2-dependent phosphorylation of this ubiquitin-conjugating enzyme functions by regulating beta-TrCP substrate recognition and induces its interaction with beta-TrCP, enhancing beta-catenin degradation. [provided by RefSeq, Jul 2008]
• Protein Pathways: Ubiquitin mediated proteolysis